PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf06923g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family HD-ZIP
Protein Properties Length: 269aa    MW: 30428 Da    PI: 7.2078
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf06923g00002.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.51.1e-18117171256
                               T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                  Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                               rk+ +++k+q  +Lee F+++++++ +++  LAk+lgL  rqV vWFqNrRa+ k
  Niben101Scf06923g00002.1 117 RKKLRLSKDQSAILEETFKEHNTLNPKQKLALAKRLGLRPRQVEVWFQNRRARTK 171
                               788899***********************************************98 PP

2HD-ZIP_I/II126.98.9e-41117206191
               HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeve 85 
                               +kk+rlsk+q+++LEe+F+e+++L+p++K +la++Lgl+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL kev+
  Niben101Scf06923g00002.1 117 RKKLRLSKDQSAILEETFKEHNTLNPKQKLALAKRLGLRPRQVEVWFQNRRARTKLKQTEVDCEFLKRCCENLTEENRRLLKEVQ 201
                               69*********************************************************************************** PP

               HD-ZIP_I/II  86 eLreel 91 
                               eLr +l
  Niben101Scf06923g00002.1 202 ELR-AL 206
                               **9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046183.5E-16295IPR006712HD-ZIP protein, N-terminal
SuperFamilySSF466892.61E-18110174IPR009057Homeodomain-like
PROSITE profilePS5007117.313113173IPR001356Homeobox domain
SMARTSM003897.4E-16115177IPR001356Homeobox domain
PfamPF000463.8E-16117171IPR001356Homeobox domain
CDDcd000866.01E-15117174No hitNo description
Gene3DG3DSA:1.10.10.607.6E-18122171IPR009057Homeodomain-like
PRINTSPR000312.5E-5144153IPR000047Helix-turn-helix motif
PROSITE patternPS000270148171IPR017970Homeobox, conserved site
PRINTSPR000312.5E-5153169IPR000047Helix-turn-helix motif
PfamPF021835.3E-11173207IPR003106Leucine zipper, homeobox-associated
SMARTSM003408.1E-26173216IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 269 aa     Download sequence    Send to blast
MMVEKEDLGL SLSLSFPDNN KNSTTNNPLQ HHQLNLIPSS SPFNLFHKTS WTDSFPSSDV  60
NRLPATADAD EEAGVSSPNN STISSVSGNK RSERETNNCE EHEIERASDE EDGETSRKKL  120
RLSKDQSAIL EETFKEHNTL NPKQKLALAK RLGLRPRQVE VWFQNRRART KLKQTEVDCE  180
FLKRCCENLT EENRRLLKEV QELRALKLSP QFYMQMTPPT TLTMCPSCER VGGPSTSSGP  240
TSSHVGPAQH RPMPFNLWAD TPQSLHPRS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1115121SRKKLRL
2165173RRARTKLKQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009589459.11e-175PREDICTED: homeobox-leucine zipper protein HAT4-like
SwissprotP466012e-99HAT2_ARATH; Homeobox-leucine zipper protein HAT2
TrEMBLA0A0V0HV351e-141A0A0V0HV35_SOLCH; Putative homeobox-leucine zipper protein HAT4-like
STRINGPGSC0003DMT4000675401e-140(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11182485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16780.15e-94homeobox protein 2